RegulonDB RegulonDB 10.9: Gene Form
   

proQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prc proQ msrC yebSp5 yebSp5 prcp1 prcp1 TSS_2178 TSS_2178 TSS_2177 TSS_2177

Gene      
Name: proQ    Texpresso search in the literature
Synonym(s): ECK1830, EG12866, b1831, yebJ, yobE, yoeC
Genome position(nucleotides): 1914836 <-- 1915534 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.93
External database links:  
ASAP:
ABE-0006092
ECHOBASE:
EB2707
ECOLIHUB:
proQ
OU-MICROARRAY:
b1831
STRING:
511145.b1831
COLOMBOS: proQ


Product      
Name: RNA chaperone ProQ
Synonym(s): ProQ, RNA chaperone, involved in posttranscriptional control of ProP levels, YebJ, YobE, YoeC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.892
Isoelectric point: 10.321
Motif(s):
 
Type Positions Sequence
182 -> 232 DISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMSLIVRAEHLVF
8 -> 115 NSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDLVDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQLEEAKARVQAQRA

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
GO:0003730 - mRNA 3'-UTR binding
GO:0033592 - RNA strand annealing activity
GO:0034057 - RNA strand-exchange activity
biological_process GO:1902836 - positive regulation of proline import across plasma membrane
GO:0071475 - cellular hyperosmotic salinity response
GO:0006974 - cellular response to DNA damage stimulus
GO:0051050 - positive regulation of transport
GO:0007231 - osmosensory signaling pathway
GO:0010608 - posttranscriptional regulation of gene expression
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
Reference(s): [1] Chaulk SG., et al., 2011
[2] Milner JL., et al., 1989
[3] Nemchinova M., et al., 2017
[4] Sharan M., et al., 2017
[5] Stalmach ME., et al., 1983
External database links:  
DIP:
DIP-10572N
DISPROT:
DP00377
ECOCYC:
EG12866-MONOMER
ECOLIWIKI:
b1831
INTERPRO:
IPR016103
INTERPRO:
IPR036442
INTERPRO:
IPR035236
INTERPRO:
IPR023529
MODBASE:
P45577
PANTHER:
PTHR38106
PDB:
5NBB
PFAM:
PF17516
PFAM:
PF04352
PRIDE:
P45577
PRODB:
PRO_000023600
REFSEQ:
YP_026161
SMART:
SM00945
SMR:
P45577
UNIPROT:
P45577


Operon      
Name: proQ-prc         
Operon arrangement:
Transcription unit        Promoter
proQ-prc


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2177 1913805 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2178 1914229 reverse nd [RS-EPT-CBR] [6]
  promoter prcp1 1915027 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yebSp5 1916119 forward Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chaulk SG., Smith Frieday MN., Arthur DC., Culham DE., Edwards RA., Soo P., Frost LS., Keates RA., Glover JN., Wood JM., 2011, ProQ is an RNA chaperone that controls ProP levels in Escherichia coli., Biochemistry 50(15):3095-106

 [2] Milner JL., Wood JM., 1989, Insertion proQ220::Tn5 alters regulation of proline porter II, a transporter of proline and glycine betaine in Escherichia coli., J Bacteriol 171(2):947-51

 [3] Nemchinova M., Balobanov V., Nikonova E., Lekontseva N., Mikhaylina A., Tishchenko S., Nikulin A., 2017, An Experimental Tool to Estimate the Probability of a Nucleotide Presence in the Crystal Structures of the Nucleotide-Protein Complexes., Protein J 36(3):157-165

 [4] Sharan M., Forstner KU., Eulalio A., Vogel J., 2017, APRICOT: an integrated computational pipeline for the sequence-based identification and characterization of RNA-binding proteins., Nucleic Acids Res 45(11):e96

 [5] Stalmach ME., Grothe S., Wood JM., 1983, Two proline porters in Escherichia coli K-12., J Bacteriol 156(2):481-6

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB