RegulonDB RegulonDB 10.9: Gene Form
   

ampH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sbmA ampH iprA sbmAp sbmAp TSS_491 TSS_491 ampHp1 ampHp1 TSS_490 TSS_490 ampHp2 ampHp2

Gene      
Name: ampH    Texpresso search in the literature
Synonym(s): ECK0371, EG12867, b0376, yaiH
Genome position(nucleotides): 395130 <-- 396287 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.35
External database links:  
ASAP:
ABE-0001292
ECHOBASE:
EB2708
ECOLIHUB:
ampH
OU-MICROARRAY:
b0376
STRING:
511145.b0376
COLOMBOS: ampH


Product      
Name: peptidoglycan DD-carboxypeptidase/peptidoglycan DD-endopeptidase
Synonym(s): AmpH, DD-carboxypeptidase/DD-endopeptidase AmpH, YaiH, penicillin-binding protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 41.849
Isoelectric point: 9.853
Motif(s):
 
Type Positions Sequence
22 -> 385 AQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS
1 -> 21 MKRSLLFSAVLCAASLTSVHA
45 -> 357 GSGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004180 - carboxypeptidase activity
GO:0004175 - endopeptidase activity
GO:0008658 - penicillin binding
biological_process GO:0006508 - proteolysis
GO:0009253 - peptidoglycan catabolic process
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47910N
ECOCYC:
EG12867-MONOMER
ECOLIWIKI:
b0376
INTERPRO:
IPR001466
INTERPRO:
IPR012338
MODBASE:
P0AD70
PFAM:
PF00144
PRIDE:
P0AD70
PRODB:
PRO_000022099
REFSEQ:
NP_414910
SMR:
P0AD70
UNIPROT:
P0AD70


Operon      
Name: ampH         
Operon arrangement:
Transcription unit        Promoter
ampH
ampH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_490 396323 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_491 396380 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB