RegulonDB RegulonDB 10.9: Gene Form
   

tusE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmI yccA tusE yccX terminator terminator TSS_1304 (cluster) TSS_1304 (cluster) TSS_1303 TSS_1303 TSS_1302 TSS_1302 TSS_1301 (cluster) TSS_1301 (cluster) TSS_1300 TSS_1300 TSS_1299 TSS_1299 TSS_1298 TSS_1298 TSS_1297 TSS_1297 TSS_1296 TSS_1296 TSS_1295 (cluster) TSS_1295 (cluster) yccXp4 yccXp4 rlmIp4 rlmIp4 yccXp7 yccXp7 yccXp5 yccXp5

Gene      
Name: tusE    Texpresso search in the literature
Synonym(s): ECK0960, EG12876, b0969, yccK
Genome position(nucleotides): 1030339 <-- 1030668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.67
External database links:  
ASAP:
ABE-0003278
ECHOBASE:
EB2714
ECOLIHUB:
yccK
OU-MICROARRAY:
b0969
STRING:
511145.b0969
COLOMBOS: tusE


Product      
Name: sulfur transfer protein TusE
Synonym(s): TusE, YccK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.41
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
108 -> 108 C
4 -> 109 FEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0097163 - sulfur carrier activity
biological_process GO:0008033 - tRNA processing
GO:0002143 - tRNA wobble position uridine thiolation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Ikeuchi Y., et al., 2006
External database links:  
DIP:
DIP-48154N
ECOCYC:
EG12876-MONOMER
ECOLIWIKI:
b0969
INTERPRO:
IPR043163
INTERPRO:
IPR007453
INTERPRO:
IPR025526
INTERPRO:
IPR042072
MODBASE:
P0AB18
PANTHER:
PTHR37010
PFAM:
PF04358
PRIDE:
P0AB18
PRODB:
PRO_000024147
REFSEQ:
NP_415489
SMR:
P0AB18
SWISSMODEL:
P0AB18
UNIPROT:
P0AB18


Operon      
Name: tusE         
Operon arrangement:
Transcription unit        Promoter
tusE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yccXp5 1029980 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yccXp7 1029994 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rlmIp4 1030001 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yccXp4 1030061 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1295 (cluster) 1030888 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1296 1030891 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1297 1031154 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1298 1031167 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1299 1031229 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1300 1031236 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1301 (cluster) 1031262 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1302 1031273 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1303 1031275 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1304 (cluster) 1031345 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ikeuchi Y., Shigi N., Kato J., Nishimura A., Suzuki T., 2006, Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions., Mol Cell 21(1):97-108

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB