RegulonDB RegulonDB 10.9: Gene Form
   

glk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeO glk fryB Cra anti-terminator terminator TSS_2676 TSS_2676 TSS_2675 (cluster) TSS_2675 (cluster) glkp glkp TSS_2674 TSS_2674 yfeOp1 yfeOp1 glkp1 glkp1 TSS_2672 TSS_2672

Gene      
Name: glk    Texpresso search in the literature
Synonym(s): ECK2384, EG12957, b2388
Genome position(nucleotides): 2508461 <-- 2509426 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0007875
CGSC:
707
ECHOBASE:
EB2791
ECOLIHUB:
glk
OU-MICROARRAY:
b2388
STRING:
511145.b2388
COLOMBOS: glk


Product      
Name: glucokinase
Synonym(s): Glk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.723
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
6 -> 315 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQ
188 -> 189 RV
108 -> 108 I
274 -> 274 A
8 -> 13 GDVGGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0004340 - glucokinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005536 - glucose binding
biological_process GO:0006096 - glycolytic process
GO:0016310 - phosphorylation
GO:0051156 - glucose 6-phosphate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Fraenkel DG., et al., 1964
[2] Fukuda Y., et al., 1983
[3] Hernandez-Montalvo V., et al., 2003
External database links:  
ECOCYC:
GLUCOKIN-MONOMER
ECOLIWIKI:
b2388
INTERPRO:
IPR003836
INTERPRO:
IPR043129
MODBASE:
P0A6V8
PDB:
1Q18
PFAM:
PF02685
PRIDE:
P0A6V8
REFSEQ:
NP_416889
SMR:
P0A6V8
UNIPROT:
P0A6V8


Operon      
Name: glk         
Operon arrangement:
Transcription unit        Promoter
glk
glk
glk
glk


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2672 2509416 reverse nd [RS-EPT-CBR] [4]
  promoter yfeOp1 2509453 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_2674 2509460 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2675 (cluster) 2509463 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2676 2509538 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Fraenkel DG., Falcoz-Kelly F., Horecker BL., 1964, The utilization of glucose 6-phosphate by glucokinaseless and wild-type strains of Escherichia coli., Proc Natl Acad Sci U S A 52:1207-13

 [2] Fukuda Y., Yamaguchi S., Shimosaka M., Murata K., Kimura A., 1983, Cloning of the glucokinase gene in Escherichia coli B., J Bacteriol 156(2):922-5

 [3] Hernandez-Montalvo V., Martinez A., Hernandez-Chavez G., Bolivar F., Valle F., Gosset G., 2003, Expression of galP and glk in a Escherichia coli PTS mutant restores glucose transport and increases glycolytic flux to fermentation products., Biotechnol Bioeng 83(6):687-94

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB