RegulonDB RegulonDB 10.8: Gene Form
   

cobU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cobT insH6 cobS cobU yeeH anti-anti-terminator anti-terminator terminator TSS_2305 TSS_2305 cobUp2 cobUp2 cobUp1 cobUp1 TSS_2304 TSS_2304 cobTp8 cobTp8

Gene      
Name: cobU    Texpresso search in the literature
Synonym(s): ECK1988, EG13238, b1993
Genome position(nucleotides): 2065219 <-- 2065764 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.55
External database links:  
ASAP:
ABE-0006616
ECHOBASE:
EB3027
OU-MICROARRAY:
b1993
PortEco:
cobU
STRING:
511145.b1993
COLOMBOS: cobU


Product      
Name: cobinamide-P guanylyltransferase / cobinamide kinase
Synonym(s): CobU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.164
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
3 -> 180 ILVTGGARSGKSRHAEALIGDSSQVLYIATSQILDDEMAARIEHHRQGRPEHWRTVERWQHLDELIHADINPNEVVLLECVTTMVTNLLFDYGGDKDPDEWDYQAMEQAINAEIQSLIAACQRCPAKVVLVTNEVGMGIVPESRLARHFRDIAGRVNQQLAAAANEVWLVVSGIGVKI
48 -> 51 RQGR
31 -> 33 ATS
7 -> 14 GGARSGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.13 - cobalamin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008819 - cobinamide kinase activity
GO:0008820 - cobinamide phosphate guanylyltransferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005525 - GTP binding
GO:0043752 - adenosylcobinamide kinase activity
biological_process GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009236 - cobalamin biosynthetic process
GO:0051188 - cofactor biosynthetic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
COBU-MONOMER
ECOLIWIKI:
b1993
INTERPRO:
IPR003203
INTERPRO:
IPR027417
MODBASE:
P0AE76
PANTHER:
PTHR34848
PFAM:
PF02283
PRIDE:
P0AE76
PRODB:
PRO_000022315
REFSEQ:
NP_416497
SMR:
P0AE76
SWISSMODEL:
P0AE76
UNIPROT:
P0AE76


Operon      
Name: cobUST         
Operon arrangement:
Transcription unit        Promoter
cobUST
cobUST


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cobTp8 2064601 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2304 2065847 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2305 2065996 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB