RegulonDB RegulonDB 11.0: Gene Form
   

xylF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylG xylA xylF xylZ xylH Fis XylR XylR Fis Fis CRP XylR AraC XylR AraC  Spot 42 anti-terminator xylFp xylFp xylAp xylAp

Gene      
Name: xylF    Texpresso search in the literature
Synonym(s): ECK3555, EG20252, b3566, xylT
Genome position(nucleotides): 3731131 --> 3732123
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.01
External database links:  
ASAP:
ABE-0011646
CGSC:
17773
ECHOBASE:
EB4153
ECOLIHUB:
xylF
OU-MICROARRAY:
b3566
STRING:
511145.b3566
COLOMBOS: xylF


Product      
Name: xylose ABC transporter periplasmic binding protein
Synonym(s): XBP, XylF, XylT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 35.734
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence Comment
1 -> 23 MKIKNILLTLCTSLLLTNVAAHA
24 -> 330 KEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFVQSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDADIDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGKIKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVAISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQEPKADTTLNNGLKDVPSRLLTPIDVNKNNIKDTVIKDGFHKESEL UniProt: D-xylose-binding periplasmic protein.
38 -> 286 ERWQKDRDIFVKKAESLGAKVFVQSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDADIDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGKIKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVAISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQE
103 -> 106 KQEG
105 -> 241 EGIKVLAYDRMINDADIDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGKIKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0030246 - carbohydrate binding
GO:0048029 - monosaccharide binding
biological_process GO:0008643 - carbohydrate transport
GO:0042732 - D-xylose metabolic process
GO:0015752 - D-ribose transmembrane transport
GO:0015753 - D-xylose transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Nicholes N., et al., 2015
[2] Ribeiro LF., et al., 2013
[3] Ribeiro LF., et al., 2016
External database links:  
ALPHAFOLD:
P37387
ECOCYC:
XYLF-MONOMER
ECOLIWIKI:
b3566
INTERPRO:
IPR025997
INTERPRO:
IPR028082
INTERPRO:
IPR013456
MODBASE:
P37387
PDB:
3M9W
PDB:
3M9X
PDB:
3MA0
PFAM:
PF13407
PRIDE:
P37387
PRODB:
PRO_000024242
REFSEQ:
NP_418023
SMR:
P37387
UNIPROT:
P37387


Operon      
Name: xylFGHR         
Operon arrangement:
Transcription unit        Promoter
xylFGHR
xylR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, XylR
Repressed by: Fis


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Nicholes N., Tullman J., Ribeiro LF., Fuzo CA., Vieira DS., Furtado GP., Ostermeier M., Ward RJ., 2015, Insertion of a xylanase in xylose binding protein results in a xylose-stimulated xylanase., Biotechnol Biofuels 8:118

 [2] Ribeiro LF., Bressan F., Furtado GP., Meireles F., Ward RJ., 2013, D-xylose detection in Escherichia coli by a xylose binding protein-dependent response., J Biotechnol 168(4):440-5

 [3] Ribeiro LF., Tullman J., Nicholes N., Silva SR., Vieira DS., Ostermeier M., Ward RJ., 2016, A xylose-stimulated xylanase-xylose binding protein chimera created by random nonhomologous recombination., Biotechnol Biofuels 9:119


RegulonDB