RegulonDB RegulonDB 11.0: Gene Form

ynaL gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

dbpA ynaL fnrS dbpAp2 dbpAp2 TSS_1769 TSS_1769 TSS_1768 TSS_1768 fnrSp fnrSp

Name: ynaL    Texpresso search in the literature
Synonym(s): C0343, ECK4600, G0-8900, b4743
Genome position(nucleotides): 1409308 --> 1409481
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: protein YnaL
Synonym(s): YnaL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.428
Isoelectric point: 5.741
Type Positions Sequence Comment
7 -> 57 LQIPVPEPIPGDPVPVPDPIPRPQPMPDPPPDEEPIKLSHRERRSARIRAC UniProt: Disordered; Sequence Annotation Type: region of interest.
12 -> 38 PEPIPGDPVPVPDPIPRPQPMPDPPPD UniProt: Pro residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1768 1409131 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1769 1409133 forward nd [RS-EPT-CBR] [1]
  promoter dbpAp2 1409338 forward nd [ICWHO] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
