RegulonDB RegulonDB 10.9: Gene Form
   

ydaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sieB racC kilR ydaE ydaF ydaEp5 ydaEp5 racCp6 racCp6 racCp4 racCp4

Gene      
Name: ydaE    Texpresso search in the literature
Synonym(s): ECK1349, G0-9081, b4526
Genome position(nucleotides): 1417838 <-- 1418008 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.84
External database links:  
ASAP:
ABE-0285047
ECHOBASE:
EB2076
ECOLIHUB:
ydaE
STRING:
511145.b4526
COLOMBOS: ydaE


Product      
Name: Rac prophage; zinc-binding protein
Synonym(s): YdaE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.584
Isoelectric point: 7.966
Motif(s):
 
Type Positions Sequence
6 -> 52 KCAYHLCKKDVEESKAIERMLHFMHGILSKDEPRKYCSEACAEKDQM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0008270 - zinc ion binding
Note(s): Note(s): ...[more].
Reference(s): [1] Kumar A., et al., 2016
[2] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
MONOMER0-1001
ECOLIWIKI:
b4526
INTERPRO:
IPR007308
PFAM:
PF04181
PRIDE:
P38394
REFSEQ:
YP_588451
UNIPROT:
P38394


Operon      
Name: kilR-ydaE         
Operon arrangement:
Transcription unit        Promoter
kilR-ydaE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter racCp4 1417811 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter racCp6 1417815 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydaEp5 1418219 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB