RegulonDB RegulonDB 10.8: Gene Form
   

yoeB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yoeB    Texpresso search in the literature
Synonym(s): ECK2011, G0-9121, b4539
Genome position(nucleotides): 2089211 <-- 2089465 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.31
External database links:  
ASAP:
ABE-0285060
ECHOBASE:
EB4102
PortEco:
yoeB
STRING:
511145.b4539
COLOMBOS: yoeB


Product      
Name: ribosome-dependent mRNA interferase toxin YoeB
Synonym(s): YoeB, toxin of the YoeB-YefM toxin-antitoxin pair
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.216
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
83 -> 83 H
84 -> 84 Y
5 -> 84 WSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
65 -> 65 R

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
GO:0016892 - endoribonuclease activity, producing 3'-phosphomonoesters
GO:0042803 - protein homodimerization activity
GO:0043024 - ribosomal small subunit binding
biological_process GO:0006401 - RNA catabolic process
GO:0009408 - response to heat
GO:0045947 - negative regulation of translational initiation
GO:0006402 - mRNA catabolic process
GO:0044010 - single-species biofilm formation
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1903507 - negative regulation of nucleic acid-templated transcription
GO:0098795 - mRNA cleavage involved in gene silencing
External database links:  
ECOCYC:
MONOMER0-1041
ECOLIWIKI:
b4539
INTERPRO:
IPR009614
INTERPRO:
IPR035093
MINT:
P69348
PANTHER:
PTHR38039
PDB:
2A6S
PDB:
2A6R
PDB:
2A6Q
PDB:
4V8X
PFAM:
PF06769
PRIDE:
P69348
REFSEQ:
YP_588458
SMR:
P69348
UNIPROT:
P69348


Operon      
Name: yefM-yoeB         
Operon arrangement:
Transcription unit        Promoter
yefM-yoeB


Transcriptional Regulation      
Display Regulation             
Repressed by: YefM-YoeB, YefM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2323 2089152 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2324 2089158 reverse nd [RS-EPT-CBR] [1]
  promoter yeeZp7 2089176 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeeZp5 2089211 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2325 2089731 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2327 2089902 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2329 2089980 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2330 (cluster) 2089990 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2331 (cluster) 2089999 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]



RegulonDB