RegulonDB RegulonDB 10.9: Gene Form
   

flgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgA flgB flgC FlhDC FlhDC FlhDC flgBp flgBp flgAp flgAp

Gene      
Name: flgB    Texpresso search in the literature
Synonym(s): ECK1058, G358, b1073, flbA
Genome position(nucleotides): 1131018 --> 1131434 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.48
External database links:  
ASAP:
ABE-0003641
CGSC:
750
ECHOBASE:
EB4014
ECOLIHUB:
flgB
OU-MICROARRAY:
b1073
STRING:
511145.b1073
COLOMBOS: flgB


Product      
Name: flagellar basal-body rod protein FlgB
Synonym(s): FlbA, FlgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cell projection
Molecular weight: 15.24
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
9 -> 39 LRFQQEALNLRAQRQEVLAANIANADTPGYQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009425 - bacterial-type flagellum basal body
GO:0030694 - bacterial-type flagellum basal body, rod
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Suzuki T., et al., 1981
External database links:  
ECOCYC:
FLGB-FLAGELLAR-MOTOR-ROD-PROTEIN
ECOLIWIKI:
b1073
INTERPRO:
IPR001444
INTERPRO:
IPR006300
INTERPRO:
IPR019776
PANTHER:
PTHR30435:SF12
PFAM:
PF00460
PRIDE:
P0ABW9
PRODB:
PRO_000022638
PROSITE:
PS00588
REFSEQ:
NP_415591
SMR:
P0ABW9
UNIPROT:
P0ABW9


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41


RegulonDB