RegulonDB RegulonDB 10.9: Gene Form
   

flgF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgE flgG flgF anti-terminator anti-anti-terminator

Gene      
Name: flgF    Texpresso search in the literature
Synonym(s): ECK1062, G362, b1077, flaX
Genome position(nucleotides): 1133802 --> 1134557 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.13
External database links:  
ASAP:
ABE-0003649
CGSC:
753
ECHOBASE:
EB4018
ECOLIHUB:
flgF
OU-MICROARRAY:
b1077
STRING:
511145.b1077
COLOMBOS: flgF


Product      
Name: flagellar basal-body rod protein FlgF
Synonym(s): FlaX, FlgF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell projection
Molecular weight: 25.912
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
5 -> 35 IYTAMGAASQTLNQQAVTASNLANASTPGFR
170 -> 247 EVQRGDDGIFRLSAETQATRGPVLQADPTLRVMSGVLEGSNVNAVAAMSDMIASARRFEMQMKVISSVDDNAGRANQL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009425 - bacterial-type flagellum basal body
GO:0030694 - bacterial-type flagellum basal body, rod
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Suzuki T., et al., 1981
External database links:  
ECOCYC:
FLGF-FLAGELLAR-MOTOR-ROD-PROTEIN
ECOLIWIKI:
b1077
INTERPRO:
IPR019776
INTERPRO:
IPR020013
INTERPRO:
IPR010930
INTERPRO:
IPR001444
INTERPRO:
IPR037925
PFAM:
PF00460
PFAM:
PF06429
PRIDE:
P75938
PRODB:
PRO_000022642
PROSITE:
PS00588
REFSEQ:
NP_415595
UNIPROT:
P75938


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41


RegulonDB