RegulonDB RegulonDB 10.9: Gene Form
   

flgG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgG flgF flgH terminator anti-terminator anti-anti-terminator

Gene      
Name: flgG    Texpresso search in the literature
Synonym(s): ECK1063, G363, b1078, flaL
Genome position(nucleotides): 1134729 --> 1135511 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0003652
CGSC:
765
ECHOBASE:
EB4019
ECOLIHUB:
flgG
OU-MICROARRAY:
b1078
STRING:
511145.b1078
COLOMBOS: flgG


Product      
Name: flagellar basal-body rod protein FlgG
Synonym(s): FlaL, FlgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,cell projection
Molecular weight: 27.744
Isoelectric point: 4.418
Motif(s):
 
Type Positions Sequence
183 -> 260 GLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL
8 -> 35 AKTGLDAQQTNMDVIANNLANVSTNGFK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009425 - bacterial-type flagellum basal body
GO:0009426 - bacterial-type flagellum basal body, distal rod
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Fujii T., et al., 2017
[2] Hiraoka KD., et al., 2017
[3] Homma M., et al., 1990
[4] Juhas M., et al., 2015
[5] Kubori T., et al., 1992
[6] Suzuki T., et al., 1981
External database links:  
ECOCYC:
FLGG-FLAGELLAR-MOTOR-ROD-PROTEIN
ECOLIWIKI:
b1078
INTERPRO:
IPR012834
INTERPRO:
IPR010930
INTERPRO:
IPR001444
INTERPRO:
IPR019776
INTERPRO:
IPR037925
INTERPRO:
IPR020013
PFAM:
PF06429
PFAM:
PF00460
PRIDE:
P0ABX5
PRODB:
PRO_000022643
PROSITE:
PS00588
REFSEQ:
NP_415596
SMR:
P0ABX5
UNIPROT:
P0ABX5


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Fujii T., Kato T., Hiraoka KD., Miyata T., Minamino T., Chevance FF., Hughes KT., Namba K., 2017, Identical folds used for distinct mechanical functions of the bacterial flagellar rod and hook., Nat Commun 8:14276

 [2] Hiraoka KD., Morimoto YV., Inoue Y., Fujii T., Miyata T., Makino F., Minamino T., Namba K., 2017, Straight and rigid flagellar hook made by insertion of the FlgG specific sequence into FlgE., Sci Rep 7:46723

 [3] Homma M., Kutsukake K., Hasebe M., Iino T., Macnab RM., 1990, FlgB, FlgC, FlgF and FlgG. A family of structurally related proteins in the flagellar basal body of Salmonella typhimurium., J Mol Biol 211(2):465-77

 [4] Juhas M., Ajioka JW., 2015, Identification and Validation of Novel Chromosomal Integration and Expression Loci in Escherichia coli Flagellar Region 1., PLoS One 10(3):e0123007

 [5] Kubori T., Shimamoto N., Yamaguchi S., Namba K., Aizawa S., 1992, Morphological pathway of flagellar assembly in Salmonella typhimurium., J Mol Biol 226(2):433-46

 [6] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41


RegulonDB