RegulonDB RegulonDB 10.9: Gene Form
   

flgH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: flgH    Texpresso search in the literature
Synonym(s): ECK1064, G364, b1079, flaY
Genome position(nucleotides): 1135564 --> 1136262 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.51
External database links:  
ASAP:
ABE-0003654
CGSC:
752
ECHOBASE:
EB4161
ECOLIHUB:
flgH
OU-MICROARRAY:
b1079
STRING:
511145.b1079
COLOMBOS: flgH


Product      
Name: flagellar L-ring protein
Synonym(s): FlaY, FlgH
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,cell projection
Molecular weight: 24.615
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
1 -> 21 MQKNAAHTYAISSLLVLSLTG
47 -> 231 ANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSP
22 -> 232 CAWIPSTPLVQGATSAQPVPGPTPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
GO:0009427 - bacterial-type flagellum basal body, distal rod, L ring
molecular_function GO:0003774 - motor activity
biological_process GO:0006970 - response to osmotic stress
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FLGH-FLAGELLAR-L-RING
ECOLIWIKI:
b1079
INTERPRO:
IPR000527
PANTHER:
PTHR34933
PFAM:
PF02107
PRIDE:
P0A6S0
PRINTS:
PR01008
PROSITE:
PS51257
REFSEQ:
NP_415597
UNIPROT:
P0A6S0


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1346 1137124 forward nd [RS-EPT-CBR] [1]



RegulonDB