RegulonDB RegulonDB 10.9: Gene Form
   

flgJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: flgJ    Texpresso search in the literature
Synonym(s): ECK1066, G366, b1081, flaZ
Genome position(nucleotides): 1137371 --> 1138312 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.67
External database links:  
ASAP:
ABE-0003658
CGSC:
751
ECHOBASE:
EB4020
ECOLIHUB:
flgJ
OU-MICROARRAY:
b1081
STRING:
511145.b1081
COLOMBOS: flgJ


Product      
Name: putative peptidoglycan hydrolase FlgJ
Synonym(s): FlaZ, FlgJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 34.475
Isoelectric point: 8.609
Motif(s):
 
Type Positions Sequence
50 -> 97 KSMRDALPKDGLFSSEHTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQ
148 -> 313 DSKAFLAQLSLPAQLASQQSGVPHHLILAQAALESGWGQRQIRRENGEPSYNLFGVKASGNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYLEALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMKSISDKVSKTYSMNIDNLF
161 -> 295 QLASQQSGVPHHLILAQAALESGWGQRQIRRENGEPSYNLFGVKASGNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYLEALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004040 - amidase activity
biological_process GO:0008152 - metabolic process
GO:0071555 - cell wall organization
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Juhas M., et al., 2015
External database links:  
CAZY:
GH73
ECOCYC:
G366-MONOMER
ECOLIWIKI:
b1081
INTERPRO:
IPR019301
INTERPRO:
IPR013377
INTERPRO:
IPR002901
PFAM:
PF01832
PFAM:
PF10135
PRIDE:
P75942
PRODB:
PRO_000022645
REFSEQ:
NP_415599
SMART:
SM00047
SMR:
P75942
UNIPROT:
P75942


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1346 1137124 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1347 1137587 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1348 1138353 forward nd [RS-EPT-CBR] [2]



RegulonDB