RegulonDB RegulonDB 10.8: Gene Form
   

fliI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliI fliG fliH fliJ fliF fliK

Gene      
Name: fliI    Texpresso search in the literature
Synonym(s): ECK1939, G377, b1941, fla, flaAIII, flaC
Genome position(nucleotides): 2016554 --> 2017927 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.59
External database links:  
ASAP:
ABE-0006460
CGSC:
772
ECHOBASE:
EB4163
OU-MICROARRAY:
b1941
PortEco:
fliI
STRING:
511145.b1941
COLOMBOS: fliI


Product      
Name: flagellum-specific ATP synthase FliI
Synonym(s): Fla, FlaC, FliI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 49.316
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
248 -> 250 QGA
381 -> 450 SEQHYARVRTFKQLLSSFQRNRDLVSVGAYAKGSDPMLDKAIALWPQLEGYLQQGIFERADWEASLQGLE
162 -> 373 GVRPINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGAEGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGISGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEASIS
239 -> 239 A
112 -> 113 LG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1)
GO:0030257 - type III protein secretion system complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0009058 - biosynthetic process
GO:0015031 - protein transport
GO:0030254 - protein secretion by the type III secretion system
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9655N
ECOCYC:
G377-MONOMER
ECOLIWIKI:
b1941
INTERPRO:
IPR005714
INTERPRO:
IPR040627
INTERPRO:
IPR032463
INTERPRO:
IPR027417
INTERPRO:
IPR020005
INTERPRO:
IPR020003
INTERPRO:
IPR003593
INTERPRO:
IPR000194
MODBASE:
P52612
PANTHER:
PTHR15184:SF9
PFAM:
PF00006
PFAM:
PF18269
PRIDE:
P52612
PRODB:
PRO_000022660
PROSITE:
PS00152
REFSEQ:
NP_416451
SMART:
SM00382
SMR:
P52612
UNIPROT:
P52612


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB