RegulonDB RegulonDB 10.9: Gene Form
   

fliK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliI fliK fliL fliJ FlhDC FlhDC fliLp2 fliLp2 fliLp1 fliLp1

Gene      
Name: fliK    Texpresso search in the literature
Synonym(s): ECK1941, G379, b1943, flaE
Genome position(nucleotides): 2018386 --> 2019513 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.88
External database links:  
ASAP:
ABE-0006464
CGSC:
770
ECHOBASE:
EB4165
ECOLIHUB:
fliK
OU-MICROARRAY:
b1943
STRING:
511145.b1943
COLOMBOS: fliK


Product      
Name: flagellar hook-length control protein
Synonym(s): FlaE, FliK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell projection
Molecular weight: 39.312
Isoelectric point: 4.126
Motif(s):
 
Type Positions Sequence
251 -> 327 FTRQGQQSAELRLHPQDLGEVQISLKVDDNQAQIQMVSPHQHVRAALEAALPVLRTQLAESGIQLGQSNISGESFSG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0009424 - bacterial-type flagellum hook
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Kinoshita M., et al., 2017
External database links:  
ECOCYC:
G379-MONOMER
ECOLIWIKI:
b1943
INTERPRO:
IPR038610
INTERPRO:
IPR021136
INTERPRO:
IPR001635
PFAM:
PF02120
PRIDE:
P52614
PRINTS:
PR01007
PRODB:
PRO_000022662
REFSEQ:
NP_416453
SMR:
P52614
UNIPROT:
P52614


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kinoshita M., Aizawa SI., Inoue Y., Namba K., Minamino T., 2017, The role of intrinsically disordered C-terminal region of FliK in substrate specificity switching of the bacterial flagellar type III export apparatus., Mol Microbiol 105(4):572-588


RegulonDB