RegulonDB RegulonDB 11.0: Gene Form
   

maa gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maa ylaC hha ylaCp ylaCp

Gene      
Name: maa    Texpresso search in the literature
Synonym(s): ECK0453, G58, b0459, ylaD
Genome position(nucleotides): 479367 <-- 479918
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0001591
ECHOBASE:
EB3990
ECOLIHUB:
maa
OU-MICROARRAY:
b0459
STRING:
511145.b0459
COLOMBOS: maa


Product      
Name: maltose O-acetyltransferase
Synonym(s): Maa, YlaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.096
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence Comment
2 -> 183 STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL UniProt: Maltose O-acetyltransferase.
7 -> 57 KMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQV
92 -> 108 CPIRIGDNCMLAPGVHI
129 -> 164 PVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTK
163 -> 164 TK UniProt: Acetyl-CoA binding; shared with dimeric partner; Sequence Annotation Type: region of interest.

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016740 - transferase activity
GO:0016407 - acetyltransferase activity
GO:0016746 - acyltransferase activity
GO:0008374 - O-acyltransferase activity
GO:0008925 - maltose O-acetyltransferase activity
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Dippel R., et al., 2005
External database links:  
ALPHAFOLD:
P77791
DIP:
DIP-10140N
ECOCYC:
MALTACETYLTRAN-MONOMER
ECOLIWIKI:
b0459
INTERPRO:
IPR018357
INTERPRO:
IPR024688
INTERPRO:
IPR011004
INTERPRO:
IPR001451
MODBASE:
P77791
PDB:
6AG8
PDB:
1OCX
PFAM:
PF12464
PFAM:
PF14602
PRIDE:
P77791
PRODB:
PRO_000023143
PROSITE:
PS00101
REFSEQ:
NP_414992
SMART:
SM01266
SMR:
P77791
UNIPROT:
P77791


Operon      
Name: maa         
Operon arrangement:
Transcription unit        Promoter
maa


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dippel R., Boos W., 2005, The maltodextrin system of Escherichia coli: metabolism and transport., J Bacteriol 187(24):8322-31


RegulonDB