RegulonDB RegulonDB 10.8: Gene Form
   

ldhA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbH ldhA hslJ ydbJ ynbE CysB TSS_1789 TSS_1789 ldhAp ldhAp ydbHp9 ydbHp9 hslJp hslJp

Gene      
Name: ldhA    Texpresso search in the literature
Synonym(s): ECK1377, G592, b1380, hslF, hslI, htpH
Genome position(nucleotides): 1441854 <-- 1442843 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.1
External database links:  
ASAP:
ABE-0004619
ECHOBASE:
EB2978
OU-MICROARRAY:
b1380
PortEco:
ldhA
STRING:
511145.b1380
COLOMBOS: ldhA


Product      
Name: D-lactate dehydrogenase
Synonym(s): D-lactate dehydrogenase - fermentative, HslF, HslI, HtpH, LdhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.535
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
205 -> 206 CP
5 -> 327 VYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFEQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKGETCPNE
110 -> 297 IGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFEQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSACHNVLFTGHQA
154 -> 155 KI
232 -> 234 TSR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008720 - D-lactate dehydrogenase activity
GO:0051287 - NAD binding
GO:0070404 - NADH binding
biological_process GO:0009408 - response to heat
GO:0055114 - oxidation-reduction process
GO:0019664 - mixed acid fermentation
External database links:  
DIP:
DIP-10087N
ECOCYC:
DLACTDEHYDROGNAD-MONOMER
ECOLIWIKI:
b1380
INTERPRO:
IPR006140
INTERPRO:
IPR036291
INTERPRO:
IPR029753
INTERPRO:
IPR029752
INTERPRO:
IPR006139
MODBASE:
P52643
PDB:
5Z1Z
PFAM:
PF00389
PFAM:
PF02826
PRIDE:
P52643
PROSITE:
PS00065
PROSITE:
PS00671
PROSITE:
PS00670
REFSEQ:
NP_415898
SMR:
P52643
SWISSMODEL:
P52643
UNIPROT:
P52643


Operon      
Name: ldhA         
Operon arrangement:
Transcription unit        Promoter
ldhA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydbHp9 1442900 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1789 1445572 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB