RegulonDB RegulonDB 11.0: Gene Form
   

yaaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaaW satP mbiA yaaI yaaWp3 yaaWp3 htgAp1 htgAp1 htgAp2 htgAp2

Gene      
Name: yaaW    Texpresso search in the literature
Synonym(s): ECK0011, G6082, b0011
Genome position(nucleotides): 10643 <-- 11356
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.84
External database links:  
ASAP:
ABE-0000037
ECHOBASE:
EB4086
ECOLIHUB:
yaaW
OU-MICROARRAY:
b0011
STRING:
511145.b0011
COLOMBOS: yaaW


Product      
Name: putative enzyme-specific chaperone YaaW
Synonym(s): YaaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.665
Isoelectric point: 9.926
Motif(s):
 
Type Positions Sequence Comment
5 -> 39 YLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRL
58 -> 220 QHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAKGVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIP
190 -> 190 L UniProt: In Ref. 1; CAA47934..

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Tutukina MN., et al., 2007
External database links:  
ALPHAFOLD:
P75617
DIP:
DIP-11163N
ECOCYC:
G6082-MONOMER
ECOLIWIKI:
b0011
INTERPRO:
IPR025217
INTERPRO:
IPR021150
PFAM:
PF03981
PFAM:
PF13099
PRIDE:
P75617
REFSEQ:
NP_414552
SMR:
P75617
UNIPROT:
P75617


Operon      
Name: yaaW         
Operon arrangement:
Transcription unit        Promoter
yaaW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaaWp3 11542 reverse nd [ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Tutukina MN., Shavkunov KS., Masulis IS., Ozoline ON., 2007, Intragenic promotor-like sites in the genome of Escherichia coli discovery and functional implication., J Bioinform Comput Biol 5(2B):549-60

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB