RegulonDB RegulonDB 10.9: Gene Form
   

yafS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gloB dnaQ yafS rnhA rnhAp rnhAp TSS_433 TSS_433 TSS_432 (cluster) TSS_432 (cluster) dnaQp2 dnaQp2 TSS_431 TSS_431 dnaQp1 dnaQp1 gloBp5 gloBp5 TSS_430 TSS_430 yafSp2 yafSp2

Gene      
Name: yafS    Texpresso search in the literature
Synonym(s): ECK0213, G6100, b0213
Genome position(nucleotides): 234816 --> 235538 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.38
External database links:  
ASAP:
ABE-0000713
ECHOBASE:
EB3115
ECOLIHUB:
yafS
OU-MICROARRAY:
b0213
STRING:
511145.b0213
COLOMBOS: yafS


Product      
Name: putative S-adenosyl-L-methionine-dependent methyltransferase
Synonym(s): YafS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.244
Isoelectric point: 10.672
Motif(s):
 
Type Positions Sequence
73 -> 125 MPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6100-MONOMER
ECOLIWIKI:
b0213
INTERPRO:
IPR029063
INTERPRO:
IPR026669
INTERPRO:
IPR013216
MODBASE:
P75672
PANTHER:
PTHR43675
PFAM:
PF08241
PRIDE:
P75672
REFSEQ:
NP_414749
SMR:
P75672
UNIPROT:
P75672


Operon      
Name: yafS         
Operon arrangement:
Transcription unit        Promoter
yafS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yafSp2 234784 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_430 234785 forward nd [RS-EPT-CBR] [2]
  promoter gloBp5 234926 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_431 235937 forward nd [RS-EPT-CBR] [2]
  promoter TSS_432 (cluster) 236020 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_433 236027 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB