RegulonDB RegulonDB 10.9: Gene Form
   

yafJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yafJ ldtF gmhA yafQ terminator TSS_444 TSS_444 yafKp6 yafKp6 TSS_443 (cluster) TSS_443 (cluster) TSS_442 TSS_442 TSS_441 TSS_441 TSS_440 (cluster) TSS_440 (cluster) TSS_439 TSS_439 TSS_438 TSS_438

Gene      
Name: yafJ    Texpresso search in the literature
Synonym(s): ECK0224, G6107, b0223
Genome position(nucleotides): 244327 --> 245094 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0000755
ECHOBASE:
EB2941
ECOLIHUB:
yafJ
OU-MICROARRAY:
b0223
STRING:
511145.b0223
COLOMBOS: yafJ


Product      
Name: putative glutamine amidotransferase YafJ
Synonym(s): YafJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.636
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
1 -> 252 MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWTYAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLADELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDVVTVIATQPLTGNETWQKIMPGEWRLFCLGE
2 -> 255 CELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWTYAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLADELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDVVTVIATQPLTGNETWQKIMPGEWRLFCLGERVV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
biological_process GO:0006541 - glutamine metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6107-MONOMER
ECOLIWIKI:
b0223
INTERPRO:
IPR017932
INTERPRO:
IPR026869
INTERPRO:
IPR029055
MODBASE:
Q47147
PFAM:
PF13230
PRIDE:
Q47147
PROSITE:
PS51278
REFSEQ:
NP_414758
SMR:
Q47147
SWISSMODEL:
Q47147
UNIPROT:
Q47147


Operon      
Name: yafJ         
Operon arrangement:
Transcription unit        Promoter
yafJ


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_438 244083 forward nd [RS-EPT-CBR] [1]
  promoter TSS_439 244089 forward nd [RS-EPT-CBR] [1]
  promoter TSS_440 (cluster) 244094 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_441 244103 forward nd [RS-EPT-CBR] [1]
  promoter TSS_442 244121 forward nd [RS-EPT-CBR] [1]
  promoter TSS_443 (cluster) 244123 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yafKp6 245993 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_444 246205 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB