RegulonDB RegulonDB 10.9: Gene Form
   

dinJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yafL yafQ dinJ DinJ-YafQ LexA yafLp6 yafLp6 dinJp dinJp TSS_445 (cluster) TSS_445 (cluster) TSS_444 TSS_444 yafKp6 yafKp6

Gene      
Name: dinJ    Texpresso search in the literature
Synonym(s): ECK0227, G6110, b0226, sosA
Genome position(nucleotides): 246242 <-- 246502 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.74
External database links:  
ASAP:
ABE-0000764
ECHOBASE:
EB2936
ECOLIHUB:
dinJ
OU-MICROARRAY:
b0226
STRING:
511145.b0226
COLOMBOS: dinJ


Product      
Name: antitoxin/DNA-binding transcriptional repressor DinJ
Synonym(s): DinJ, DinJ antitoxin of YafQ-DinJ toxin-antitoxin system / DNA-binding transcriptional repressor, SosA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.406
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
4 -> 83 NAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDK
35 -> 35 R
2 -> 44 AANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVARE
10 -> 10 R

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0015643 - toxic substance binding
GO:0042803 - protein homodimerization activity
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0044010 - single-species biofilm formation
GO:2000143 - negative regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9446N
ECOCYC:
G6110-MONOMER
ECOLIWIKI:
b0226
INTERPRO:
IPR007337
INTERPRO:
IPR013321
INTERPRO:
IPR026262
PANTHER:
PTHR38781
PDB:
4Q2U
PFAM:
PF04221
PRIDE:
Q47150
REFSEQ:
NP_414761
SMR:
Q47150
UNIPROT:
Q47150


Operon      
Name: dinJ-yafQ         
Operon arrangement:
Transcription unit        Promoter
dinJ-yafQ


Transcriptional Regulation      
Display Regulation             
Repressed by: DinJ-YafQ, LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yafKp6 245993 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_444 246205 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_445 (cluster) 246533 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter yafLp6 246641 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB