RegulonDB RegulonDB 10.9: Gene Form
   

yafP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepD prfH yafP yafO ykfJ

Gene      
Name: yafP    Texpresso search in the literature
Synonym(s): ECK0235, G6118, b0234
Genome position(nucleotides): 252709 --> 253161 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.27
External database links:  
ASAP:
ABE-0000801
ECHOBASE:
EB2947
ECOLIHUB:
yafP
OU-MICROARRAY:
b0234
STRING:
511145.b0234
COLOMBOS: yafP


Product      
Name: putative acyltransferase with acyl-CoA N-acyltransferase domain
Synonym(s): YafP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.555
Isoelectric point: 9.619
Motif(s):
 
Type Positions Sequence
31 -> 141 QHYSPQQISAWAQIDESRWKEKLAKSQVWVAIINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSESELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTN
4 -> 149 IQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQIDESRWKEKLAKSQVWVAIINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSESELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFYMRYKPQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6118-MONOMER
ECOLIWIKI:
b0234
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
Q47158
PFAM:
PF13673
PRIDE:
Q47158
PROSITE:
PS51186
REFSEQ:
NP_414769
SMR:
Q47158
UNIPROT:
Q47158


Operon      
Name: dinB-yafNOP         
Operon arrangement:
Transcription unit        Promoter
dinB-yafNOP
dinB-yafNOP
yafNOP


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB