RegulonDB RegulonDB 10.9: Gene Form
   

yafW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfI yafW ykfH ykfIp7 ykfIp7

Gene      
Name: yafW    Texpresso search in the literature
Synonym(s): ECK0247, G6121, b0246
Genome position(nucleotides): 263690 <-- 264007 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.92
External database links:  
ASAP:
ABE-0000838
ECHOBASE:
EB3119
ECOLIHUB:
yafW
ECOO157CYC:
Z1220
ECOO157CYC:
Z1658
OU-MICROARRAY:
b0246
STRING:
511145.b0246
COLOMBOS: yafW


Product      
Name: antitoxin of the YkfI-YafW toxin-antitoxin pair
Synonym(s): YafW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.94
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
6 -> 104 RGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYHNDLTCEADTLGSCGYVYIAIYPTQ

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051495 - positive regulation of cytoskeleton organization
Note(s): Note(s): ...[more].
Evidence: [AUPEINH] Assay of unpurified protein expressed in its native host
Reference(s): [1] Brown JM., et al., 2003
External database links:  
ECOCYC:
G6121-MONOMER
ECOLIWIKI:
b0246
ECOO157CYC:
Z1658-MONOMER
ECOO157CYC:
Z1220-MONOMER
INTERPRO:
IPR009320
INTERPRO:
IPR038025
PFAM:
PF06154
PRIDE:
Q47684
REFSEQ:
NP_414780
SMR:
Q47684
UNIPROT:
Q47684


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
yafY-ykfBF-yafX-ykfGH-yafW-ykfI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykfIp7 263818 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB