RegulonDB RegulonDB 10.9: Gene Form
   

ykfB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfB yafY ykfF anti-terminator terminator ykfBp2 ykfBp2 ykfBp1 ykfBp1

Gene      
Name: ykfB    Texpresso search in the literature
Synonym(s): ECK0252, G6125, b0250
Genome position(nucleotides): 265620 <-- 266087 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0000851
ECHOBASE:
EB3318
ECOLIHUB:
ykfB
OU-MICROARRAY:
b0250
STRING:
511145.b0250
COLOMBOS: ykfB


Product      
Name: CP4-6 prophage; protein YkfB
Synonym(s): YkfB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.026
Isoelectric point: 4.266
Motif(s):
 
Type Positions Sequence
1 -> 23 MTILSLSRFMLAGVLLASFNASA
24 -> 155 IPGFWQQGYGQGNTEYSVTEASGKTFTINCTGNPDQNGFYQHSVFLTLADDKMVSSHDDDTTITVVMDHQQYIIPSSLGWRNGDNAWFDFISNISEAGQFDVYVNDHKAGTFTADRKNAEKVLSTLGDCSND

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6125-MONOMER
ECOLIWIKI:
b0250
PRIDE:
P77162
REFSEQ:
NP_414784
UNIPROT:
P77162


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
yafY-ykfBF-yafX-ykfGH-yafW-ykfI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB