RegulonDB RegulonDB 10.9: Gene Form
   

insI1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insI1 perR eyeA TSS_465 TSS_465 insN-1p insN-1p

Gene      
Name: insI1    Texpresso search in the literature
Synonym(s): ECK0258, G6131, b0256, tra8-1
Genome position(nucleotides): 270603 --> 271754 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
External database links:  
ASAP:
ABE-0000871
ECHOBASE:
EB4703
ECOLIHUB:
insI-1
ECOO157CYC:
TRA8_3
ECOO157CYC:
Z1572
ECOO157CYC:
Z1133
OU-MICROARRAY:
b0256
STRING:
511145.b0256
COLOMBOS: insI1


Product      
Name: IS30 transposase
Synonym(s): InsI1, Tra8-1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.267
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
58 -> 98 HLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREVQRN
230 -> 320 SLGHWEGDLVSGTKNSHIATLVDRKSRYTIIVRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSP
213 -> 379 VNGTPIHERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIIVRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIERGV

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0004803 - transposase activity
GO:0043565 - sequence-specific DNA binding
GO:0032135 - DNA insertion or deletion binding
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6131-MONOMER
ECOLIWIKI:
b0256
ECOO157CYC:
Z1133-MONOMER
ECOO157CYC:
TRA8_3-MONOMER
ECOO157CYC:
Z1572-MONOMER
INTERPRO:
IPR001584
INTERPRO:
IPR036397
INTERPRO:
IPR025246
INTERPRO:
IPR012337
INTERPRO:
IPR001598
MODBASE:
P0CF88
PFAM:
PF13936
PFAM:
PF00665
PRIDE:
P0CF88
PRODB:
PRO_000023023
PROSITE:
PS50994
PROSITE:
PS01043
REFSEQ:
NP_414790
UNIPROT:
P0CF88


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_465 270588 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB