RegulonDB RegulonDB 10.9: Gene Form
   

insB2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB2 insB2 afuB insA2 insI2 TSS_469 TSS_469 TSS_468 TSS_468 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: insB2    Texpresso search in the literature
Synonym(s): ECK0022, G6138, b0264
Genome position(nucleotides): 279178 <-- 279681 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.16
External database links:  
ASAP:
ABE-0000906
ECOLIHUB:
insB-2
ECOO157CYC:
Z1123
ECOO157CYC:
Z5491
ECOO157CYC:
Z1632
ECOO157CYC:
Z1192
ECOO157CYC:
Z1562
OU-MICROARRAY:
b0264
STRING:
511145.b0274
COLOMBOS: insB2


Product      
Name: IS1 protein InsB
Synonym(s): InsB2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.758
Isoelectric point: 10.847
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVEQHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
G6138-MONOMER
ECOLIWIKI:
b0264
ECOO157CYC:
Z5491-MONOMER
ECOO157CYC:
Z1632-MONOMER
ECOO157CYC:
Z1562-MONOMER
ECOO157CYC:
Z1192-MONOMER
ECOO157CYC:
Z1123-MONOMER
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P0CF26
PRODB:
PRO_000023016
REFSEQ:
NP_414798
UNIPROT:
P0CF26


Operon      
Name: insAB2A2B2-afuBC         
Operon arrangement:
Transcription unit        Promoter
insA2B2AB2-afuBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB