RegulonDB RegulonDB 10.9: Gene Form
   

yagE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagF yagA yagE anti-terminator anti-anti-terminator yagEp8 yagEp8 yagEp3 yagEp3

Gene      
Name: yagE    Texpresso search in the literature
Synonym(s): ECK0269, G6140, b0268
Genome position(nucleotides): 282278 --> 283186 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
61.61
External database links:  
ASAP:
ABE-0000921
ECHOBASE:
EB3128
ECOLIHUB:
yagE
MIM:
613616
OU-MICROARRAY:
b0268
STRING:
511145.b0268
COLOMBOS: yagE


Product      
Name: CP4-6 prophage; putative 2-dehydro-3-deoxygluconate aldolase
Synonym(s): YagE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.53
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
7 -> 298 FTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0061677 - 2-dehydro-3-deoxy-D-gluconate aldolase activity
GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0042802 - identical protein binding
GO:0047440 - 2-dehydro-3-deoxy-D-pentonate aldolase activity
biological_process GO:0046176 - aldonic acid catabolic process
External database links:  
DIP:
DIP-11232N
ECOCYC:
G6140-MONOMER
ECOLIWIKI:
b0268
INTERPRO:
IPR020625
INTERPRO:
IPR020624
INTERPRO:
IPR013785
INTERPRO:
IPR002220
MODBASE:
P75682
PANTHER:
PTHR12128
PDB:
4PTN
PDB:
2V8Z
PDB:
4OE7
PDB:
3NEV
PDB:
4U4M
PDB:
4ONV
PDB:
2V9D
PDB:
3N2X
PFAM:
PF00701
PRIDE:
P75682
PRINTS:
PR00146
PROSITE:
PS00666
PROSITE:
PS00665
REFSEQ:
NP_414802
SMART:
SM01130
SMR:
P75682
UNIPROT:
P75682


Operon      
Name: yagEF         
Operon arrangement:
Transcription unit        Promoter
yagEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yagEp3 282223 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yagEp8 282252 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB