RegulonDB RegulonDB 10.9: Gene Form
   

insB3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagJ insAB3 insB3 insA3 ykgS terminator TSS_472 TSS_472

Gene      
Name: insB3    Texpresso search in the literature
Synonym(s): ECK0022, G6145, b0274
Genome position(nucleotides): 290649 <-- 291152 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.16
External database links:  
ASAP:
ABE-0000948
ECOLIHUB:
insB-3
OU-MICROARRAY:
b0274
COLOMBOS: insB3


Product      
Name: IS1 protein InsB
Synonym(s): InsB3
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.758
Isoelectric point: 10.847
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVEQHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4440
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P0CF27
REFSEQ:
NP_414808
UNIPROT:
P0CF27


Operon      
Name: insAB3A3B3         
Operon arrangement:
Transcription unit        Promoter
insA3B3AB3


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_472 291181 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB