RegulonDB RegulonDB 11.0: Gene Form
   

matA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

matA ecpA ykgL anti-terminator terminator ykgLp1 ykgLp1 matAp7 matAp7 matAp10 matAp10 matAp5 matAp5 matAp9 matAp9 ecpRp ecpRp ecpAp ecpAp ecpBp1 ecpBp1

Gene      
Name: matA    Texpresso search in the literature
Synonym(s): ECK0293, G6165, b0294, ecpR, ykgK
Genome position(nucleotides): 310746 <-- 311336
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.09
External database links:  
ASAP:
ABE-0001011
ECHOBASE:
EB4070
ECOLIHUB:
matA
OU-MICROARRAY:
b0294
STRING:
511145.b0294
COLOMBOS: matA


Product      
Name: DNA-binding transcriptional dual regulator MatA
Synonym(s): EcpR, MatA, YkgK
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 23.274
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence Comment
138 -> 196 KDIKKDKITDREMEIIRMTAQGMQPKSIARIENCSVKTVYTHRRNAEAKLYSKIYKLVQ UniProt: HTH luxR-type.
145 -> 187 ITDREMEIIRMTAQGMQPKSIARIENCSVKTVYTHRRNAEAKL
162 -> 181 PKSIARIENCSVKTVYTHRR UniProt: H-T-H motif.
179 -> 179 H UniProt: Slightly increases motility..

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005667 - transcription regulator complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:1902021 - regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
Reference(s): [1] Lehti TA., et al., 2012
[2] Perez-Rueda E., et al., 2004
External database links:  
ALPHAFOLD:
P71301
ECOCYC:
G6165-MONOMER
ECOLIWIKI:
b0294
INTERPRO:
IPR016032
INTERPRO:
IPR036388
INTERPRO:
IPR000792
MODBASE:
P71301
PFAM:
PF00196
PRIDE:
P71301
PRINTS:
PR00038
PROSITE:
PS50043
REFSEQ:
NP_414828
SMART:
SM00421
SMR:
P71301
UNIPROT:
P71301


Operon      
Name: matA         
Operon arrangement:
Transcription unit        Promoter
ecpR


Transcriptional Regulation      
Display Regulation             
Activated by: MatA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter matAp9 311432 reverse nd [ICWHO] [3]
  promoter matAp5 311446 reverse nd [ICWHO] [3]
  promoter matAp10 311460 reverse nd [ICWHO] [3]
  promoter matAp7 311482 reverse nd [ICWHO] [3]
  promoter ykgLp1 311939 forward nd [ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lehti TA., Bauchart P., Dobrindt U., Korhonen TK., Westerlund-Wikstrom B., 2012, The fimbriae activator MatA switches off motility in Escherichia coli by repression of the flagellar master operon flhDC., Microbiology 158(Pt 6):1444-55

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB