RegulonDB RegulonDB 10.9: Gene Form
   

yahD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yahE yahD yahC yahF yahEp yahEp yahCp5 yahCp5

Gene      
Name: yahD    Texpresso search in the literature
Synonym(s): ECK0316, G6183, b0318
Genome position(nucleotides): 335280 --> 335885 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.38
External database links:  
ASAP:
ABE-0001095
ECHOBASE:
EB3358
ECOLIHUB:
yahD
OU-MICROARRAY:
b0318
STRING:
511145.b0318
COLOMBOS: yahD


Product      
Name: ankyrin repeat-containing protein YahD
Synonym(s): YahD, putative transcriptional regulator with ankyrin domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.687
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
5 -> 34 NLPADYLLAAQQGDIDKVKTCLALGVDINT
13 -> 59 AAQQGDIDKVKTCLALGVDINTCDRQGKTAITLASLYQQYACVQALI
38 -> 67 QGKTAITLASLYQQYACVQALIDAGADINK
176 -> 201 YGKTPLELARERGFEEIAQLLIAAGA
78 -> 174 ISCLNDDLTLLRIILPAKPDLNCVTRFGGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLLLEHGASPHLTD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0009314 - response to radiation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6183-MONOMER
ECOLIWIKI:
b0318
INTERPRO:
IPR020683
INTERPRO:
IPR002110
INTERPRO:
IPR036770
MODBASE:
P77736
PFAM:
PF13637
PFAM:
PF12796
PRIDE:
P77736
PROSITE:
PS50297
PROSITE:
PS50088
REFSEQ:
NP_414852
SMART:
SM00248
SMR:
P77736
UNIPROT:
P77736


Operon      
Name: yahDEFG         
Operon arrangement:
Transcription unit        Promoter
yahE
yahDEFG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yahCp5 335068 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB