RegulonDB RegulonDB 10.9: Gene Form
   

yahE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yahF yahG yahE yahD yahEp yahEp

Gene      
Name: yahE    Texpresso search in the literature
Synonym(s): ECK0317, G6184, b0319
Genome position(nucleotides): 335925 --> 336788 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.11
External database links:  
ASAP:
ABE-0001097
ECHOBASE:
EB3359
ECOLIHUB:
yahE
OU-MICROARRAY:
b0319
STRING:
511145.b0319
COLOMBOS: yahE


Product      
Name: DUF2877 domain-containing protein YahE
Synonym(s): YahE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.266
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
167 -> 274 MMGLGIGLTPSADDYLTGLALILFIPGHPAEKYKEEFYLGLQRGKNNTTLLSAITLEAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6184-MONOMER
ECOLIWIKI:
b0319
INTERPRO:
IPR021530
PFAM:
PF11392
PRIDE:
P77297
REFSEQ:
NP_414853
UNIPROT:
P77297


Operon      
Name: yahDEFG         
Operon arrangement:
Transcription unit        Promoter
yahE
yahDEFG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB