RegulonDB RegulonDB 10.8: Gene Form
   

yahF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yahF    Texpresso search in the literature
Synonym(s): ECK0318, G6185, b0320
Genome position(nucleotides): 336778 --> 338325 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0001099
ECHOBASE:
EB3360
OU-MICROARRAY:
b0320
PortEco:
yahF
STRING:
511145.b0320
COLOMBOS: yahF


Product      
Name: putative acyl-CoA synthetase YahF
Synonym(s): YahF, putative acyl-CoA synthetase with NAD(P)-binding domain and succinyl-CoA synthetase domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 55.581
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
189 -> 281 RGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGTGGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
346 -> 503 LFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFTNGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIETIKEAKAIAAAEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0048037 - cofactor binding
GO:0004550 - nucleoside diphosphate kinase activity
GO:0004775 - succinate-CoA ligase (ADP-forming) activity
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0009142 - nucleoside triphosphate biosynthetic process
GO:0006165 - nucleoside diphosphate phosphorylation
GO:0006105 - succinate metabolic process
GO:0006104 - succinyl-CoA metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11258N
ECOCYC:
G6185-MONOMER
ECOLIWIKI:
b0320
INTERPRO:
IPR016102
INTERPRO:
IPR005811
INTERPRO:
IPR003781
MINT:
MINT-1241539
MODBASE:
P77187
PFAM:
PF02629
PFAM:
PF00549
PRIDE:
P77187
REFSEQ:
NP_414854
SMR:
P77187
UNIPROT:
P77187


Operon      
Name: yahDEFG         
Operon arrangement:
Transcription unit        Promoter
yahE
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB