RegulonDB RegulonDB 10.9: Gene Form
   

yahJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yahJ yahK yahI TSS_481 TSS_481 TSS_480 TSS_480

Gene      
Name: yahJ    Texpresso search in the literature
Synonym(s): ECK0322, G6189, b0324
Genome position(nucleotides): 341125 --> 342507 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.25
External database links:  
ASAP:
ABE-0001109
ECHOBASE:
EB3363
ECOLIHUB:
yahJ
OU-MICROARRAY:
b0324
STRING:
511145.b0324
COLOMBOS: yahJ


Product      
Name: amidohydrolase family protein YahJ
Synonym(s): YahJ, putative deaminase with metallo-dependent hydrolase domain
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 50.549
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
34 -> 460 AVAGTLNCEANNTMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKLHPDATLPHYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGLLLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTPAGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELANRMVVQQISIASTVPIGTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSLFLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSVAG
1 -> 33 MKESNSRREFLSQSGKMVTAAALFGTSVPLAHA
167 -> 431 EKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGLLLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTPAGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELANRMVVQQISIASTVPIGTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSLFLATGDVLPLNEKGERVWPKAQDDASFVLVDA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016814 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11262N
ECOCYC:
G6189-MONOMER
ECOLIWIKI:
b0324
INTERPRO:
IPR032466
INTERPRO:
IPR011059
INTERPRO:
IPR006311
INTERPRO:
IPR013108
MODBASE:
P77554
PFAM:
PF07969
PRIDE:
P77554
PROSITE:
PS51318
REFSEQ:
NP_414858
SMR:
P77554
UNIPROT:
P77554


Operon      
Name: yahIJ         
Operon arrangement:
Transcription unit        Promoter
yahIJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_480 342818 forward nd [RS-EPT-CBR] [1]
  promoter TSS_481 342838 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB