RegulonDB RegulonDB 10.9: Gene Form
   

yahK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yahJ yahK yahL TSS_481 TSS_481 TSS_480 TSS_480

Gene      
Name: yahK    Texpresso search in the literature
Synonym(s): ECK0323, G6190, b0325
Genome position(nucleotides): 342884 --> 343933 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0001113
ECHOBASE:
EB3364
ECOLIHUB:
yahK
OU-MICROARRAY:
b0325
STRING:
511145.b0325
COLOMBOS: yahK


Product      
Name: aldehyde reductase, NADPH-dependent
Synonym(s): AdhZ2, YahK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 37.978
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
27 -> 142 PNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKYAPGDLVGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLR
116 -> 116 S
185 -> 308 GLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEVVNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFNLIMKRRAIAGSMIGGIPETQEMLDFCA
145 -> 145 H

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
GO:0008106 - alcohol dehydrogenase (NADP+) activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11263N
ECOCYC:
G6190-MONOMER
ECOLIWIKI:
b0325
INTERPRO:
IPR013149
INTERPRO:
IPR036291
INTERPRO:
IPR029752
INTERPRO:
IPR020843
INTERPRO:
IPR013154
INTERPRO:
IPR002328
INTERPRO:
IPR011032
MODBASE:
P75691
PDB:
1UUF
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P75691
PROSITE:
PS00059
REFSEQ:
NP_414859
SMART:
SM00829
SMR:
P75691
UNIPROT:
P75691


Operon      
Name: yahK         
Operon arrangement:
Transcription unit        Promoter
yahK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_480 342818 forward nd [RS-EPT-CBR] [1]
  promoter TSS_481 342838 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB