RegulonDB RegulonDB 10.9: Gene Form
   

yahN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yahN yahO yahM yahNp6 yahNp6 yahNp5 yahNp5 yahOp yahOp TSS_482 TSS_482

Gene      
Name: yahN    Texpresso search in the literature
Synonym(s): ECK0326, G6193, b0328
Genome position(nucleotides): 345666 <-- 346337 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.4
External database links:  
ASAP:
ABE-0001122
ECHOBASE:
EB3367
ECOLIHUB:
yahN
OU-MICROARRAY:
b0328
STRING:
511145.b0328
COLOMBOS: yahN


Product      
Name: putative amino acid exporter YahN
Synonym(s): YahN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.811
Isoelectric point: 10.379
Motif(s):
 
Type Positions Sequence
59 -> 79 GVALGDAFYSGLGLFGLATLI
29 -> 219 ITFFNPGANLFVVVQTSLASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPISAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEG
85 -> 105 IFSLIRIVGGAYLLWFAWCSM
213 -> 223 LRLIYEGVTQR
22 -> 42 LTVGLFVITFFNPGANLFVVV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015171 - amino acid transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0003333 - amino acid transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Eggeling L., et al., 2003
[2] Jindal S., et al., 2019
External database links:  
ECOCYC:
G6193-MONOMER
ECOLIWIKI:
b0328
INTERPRO:
IPR001123
INTERPRO:
IPR004778
PANTHER:
PTHR30086
PFAM:
PF01810
PRIDE:
P75693
REFSEQ:
NP_414862
UNIPROT:
P75693


Operon      
Name: yahN         
Operon arrangement:
Transcription unit        Promoter
yahN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_482 346422 forward nd [RS-EPT-CBR] [3]
  promoter yahNp5 346435 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yahNp6 346436 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Eggeling L., Sahm H., 2003, New ubiquitous translocators: amino acid export by Corynebacterium glutamicum and Escherichia coli., Arch Microbiol 180(3):155-60

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB