RegulonDB RegulonDB 10.9: Gene Form
   

yaiP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaiP insD1 insCD1 ykiC insC1 yaiS yaiPp5 yaiPp5

Gene      
Name: yaiP    Texpresso search in the literature
Synonym(s): ECK0360, G6215, b0363
Genome position(nucleotides): 382739 <-- 383935 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.96
External database links:  
ASAP:
ABE-0001243
ECHOBASE:
EB3083
ECOLIHUB:
yaiP
OU-MICROARRAY:
b0363
STRING:
511145.b0363
COLOMBOS: yaiP


Product      
Name: putative glucosyltransferase
Synonym(s): YaiP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.708
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence
146 -> 149 IPST
34 -> 200 AIIPAYNEGPCLAQSLDNLLRNPYFCRVICVNDGSTDNTEAVMAEVKRKWGDRFVAVTQKNTGKGGALMNGLNYATCDQVFLSDADTYVPPDQDGMGYMLAEIERGADAVGGIPSTALKGAGLLPHIRATVKLPMIVMKRTLQQLLGGAPFIISGACGMFRTDVLRK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.9 - cytoplasmic polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0016874 - ligase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT2
DIP:
DIP-11277N
ECOCYC:
G6215-MONOMER
ECOLIWIKI:
b0363
INTERPRO:
IPR001173
INTERPRO:
IPR029044
MODBASE:
Q47536
PFAM:
PF00535
PRIDE:
Q47536
REFSEQ:
NP_414897
UNIPROT:
Q47536


Operon      
Name: yaiP         
Operon arrangement:
Transcription unit        Promoter
yaiP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiPp5 383985 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB