RegulonDB RegulonDB 10.9: Gene Form
   

tauB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tauA tauD tauC tauB

Gene      
Name: tauB    Texpresso search in the literature
Synonym(s): ECK0363, G6218, b0366, ssiB, yaiQ
Genome position(nucleotides): 386207 --> 386974 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.99
External database links:  
ASAP:
ABE-0001259
ECHOBASE:
EB3084
ECOLIHUB:
tauB
OU-MICROARRAY:
b0366
STRING:
511145.b0366
COLOMBOS: tauB


Product      
Name: taurine ABC transporter ATP binding subunit
Synonym(s): SsiB, TauB, YaiQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 28.297
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
17 -> 156 LEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQRLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPF
2 -> 229 LQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQRLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTRDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLPLNFARRFVAGESSRS
149 -> 155 LLLLDEP
34 -> 41 GPSGCGKT
129 -> 132 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005368 - taurine transmembrane transporter activity
GO:0015411 - ATPase-coupled taurine transporter activity
biological_process GO:0015734 - taurine transport
GO:0010438 - cellular response to sulfur starvation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TAUB-MONOMER
ECOLIWIKI:
b0366
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR015859
MODBASE:
Q47538
PFAM:
PF00005
PRIDE:
Q47538
PRODB:
PRO_000024034
PROSITE:
PS51250
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_414900
SMART:
SM00382
SWISSMODEL:
Q47538
UNIPROT:
Q47538


Operon      
Name: tauABCD         
Operon arrangement:
Transcription unit        Promoter
tauABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, Cbl


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB