RegulonDB RegulonDB 10.9: Gene Form
   

tauC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemB tauA tauD tauC tauB

Gene      
Name: tauC    Texpresso search in the literature
Synonym(s): ECK0364, G6219, b0367, ssiC, yaiJ
Genome position(nucleotides): 386971 --> 387798 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.25
External database links:  
ASAP:
ABE-0001261
ECHOBASE:
EB3086
ECOLIHUB:
tauC
OU-MICROARRAY:
b0367
STRING:
511145.b0367
COLOMBOS: tauC


Product      
Name: taurine ABC transporter membrane subunit
Synonym(s): G6219, SsiC, TauC, YaiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 29.812
Isoelectric point: 11.184
Motif(s):
 
Type Positions Sequence
80 -> 264 LAASLTRIMLALFAAVLFGIPVGIAMGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSVQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQ
186 -> 206 VLWFVILPGALPEILTGLRIG
74 -> 74 A
124 -> 144 PVPPLAYLPLMVIWFGIGETS
209 -> 229 VGWSTLVAAELIAATRGLGFM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005368 - taurine transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042959 - alkanesulfonate transmembrane transporter activity
biological_process GO:0015734 - taurine transport
GO:0055085 - transmembrane transport
GO:0042918 - alkanesulfonate transport
GO:0010438 - cellular response to sulfur starvation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TAUC-MONOMER
ECOLIWIKI:
b0367
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
Q47539
PRODB:
PRO_000024035
PROSITE:
PS50928
REFSEQ:
NP_414901
UNIPROT:
Q47539


Operon      
Name: tauABCD         
Operon arrangement:
Transcription unit        Promoter
tauABCD


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, CysB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB