RegulonDB RegulonDB 10.9: Gene Form
   

yaiT gene in Escherichia coli K-12 genome

Gene      
Name: yaiT    Texpresso search in the literature
Synonym(s): ECK0368, ECK0369, G6222, b0371, b0374, b4580, yaiU
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.3
External database links:  
ASAP:
ABE-0285112
ASAP:
ABE-0001288
ASAP:
ABE-0001274
ECHOBASE:
EB3373
ECHOBASE:
EB4319
ECOLIHUB:
yaiU
ECOLIHUB:
yaiT
ECOLIWIKI:
b0374
OU-MICROARRAY:
b0371
OU-MICROARRAY:
b0374
STRING:
316407.85674512
UNIPROT:
P77199
COLOMBOS: yaiT


Product      
Name: putative autotransporter YaiT
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 3.821
Motif(s):
 
Type Positions Sequence
1 -> 27 MHSWKKKLVVSQLALACTLAITSQANA
28 -> 968 ANYDTWTYIDNPVTALDWDHMDKAGTVDGNYVNYSGFVYYNNTNGDFDQSFNGDTVNGTISTYYLNHDYADSTANQLDISNSVIHGSITSMLPGGYYDRFDADGNNLGGYDFYTDAVVDTHWRDGDVFTLNIANTTIDDDYEALYFTDSYKDGDVTKHTNETFDTSEGVAVNLDVESNINISNNSRVAGIALSQGNTYNETYTTESHTWDNNISVKDSTVTSGSNYILDSNTYGKTGHFGNSDEPSDYAGPGDVAMSFTASGSDYAMKNNVFLSNSTLMGDVAFTSTWNSNFDPNGHDSNGDGVKDTNGGWTDDSLNVDELNLTLDNGSKWVGQAIYNVAETSAMYDVATNSLTPDATYENNDWKRVVDDKVFQSGVFNVALNNGSEWDTTGRSIVDTLTVNNGSQVNVSESKLTSDTIDLTNGSSLNIGEDGYVDTDHLTINSYSTVALTESTGWGADYNLYANTITVTNGGVLDVNVDQFDTEAFRTDKLELTSGNIADHNGNVVSGVFDIHSSDYVLNADLVNDRTWDTSKSNYGYGIVAMNSDGHLTINGNGDVDNGTELDNSSVDNVVAATGNYKVRIDNATGAGAIADYKDKEIIYVNDVNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSANTNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHFNNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSIDNGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW
703 -> 968 GLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHFNNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSIDNGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0019867 - outer membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11280N
ECOCYC:
G6222-MONOMER
ECOLIWIKI:
b0371
ECOO157CYC:
Z0469-MONOMER
INTERPRO:
IPR012332
INTERPRO:
IPR036709
INTERPRO:
IPR011050
INTERPRO:
IPR006315
INTERPRO:
IPR004899
INTERPRO:
IPR003991
INTERPRO:
IPR005546
MODBASE:
P77199
PFAM:
PF03212
PFAM:
PF03797
PRIDE:
P77199
PRINTS:
PR01484
PROSITE:
PS51208
SMART:
SM00869
SMR:
P77199
UNIPROT:
P77199


Operon      
Name: yaiT         
Operon arrangement:
Transcription unit        Promoter
yaiT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB