RegulonDB RegulonDB 10.9: Gene Form
   

iprA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ampH iprA insEF2 insE2 insF2 yaiVp4 yaiVp4 TSS_488 TSS_488 insFp4 insFp4 insFp5 insFp5

Gene      
Name: iprA    Texpresso search in the literature
Synonym(s): ECK0370, G6226, b0375, yaiV
Genome position(nucleotides): 394506 --> 395129 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.42
External database links:  
ASAP:
ABE-0001290
ECHOBASE:
EB3374
ECOLIHUB:
yaiV
OU-MICROARRAY:
b0375
STRING:
511145.b0375
COLOMBOS: iprA


Product      
Name: putative DNA-binding transcriptional regulator IprA
Synonym(s): IprA, YaiV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.956
Isoelectric point: 8.185
Motif(s):
 
Type Positions Sequence
163 -> 182 MNYIHQRTRISRSVVAEVLA
138 -> 205 SYEQIRATLLSMIDWNEELRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006351 - transcription, DNA-templated
GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Herman A., et al., 2016
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G6226-MONOMER
ECOLIWIKI:
b0375
INTERPRO:
IPR034719
INTERPRO:
IPR041687
INTERPRO:
IPR018490
MODBASE:
P0AAP5
PFAM:
PF15977
PRIDE:
P0AAP5
REFSEQ:
NP_414909
SMR:
P0AAP5
UNIPROT:
P0AAP5


Operon      
Name: iprA         
Operon arrangement:
Transcription unit        Promoter
iprA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 392619 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter insFp4 392660 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_488 392979 reverse nd [RS-EPT-CBR] [4]
  promoter yaiVp4 394461 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Herman A., Serfecz J., Kinnally A., Crosby K., Youngman M., Wykoff D., Wilson JW., 2016, The Bacterial iprA Gene Is Conserved across Enterobacteriaceae, Is Involved in Oxidative Stress Resistance, and Influences Gene Expression in Salmonella enterica Serovar Typhimurium., J Bacteriol 198(16):2166-79

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB