RegulonDB RegulonDB 10.9: Gene Form
   

yaiZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddlA yaiY yaiZ TSS_492 (cluster) TSS_492 (cluster) yaiYp6 yaiYp6 yaiYp5 yaiYp5 yaiZp yaiZp yaiZp6 yaiZp6

Gene      
Name: yaiZ    Texpresso search in the literature
Synonym(s): ECK0375, G6229, b0380
Genome position(nucleotides): 399593 --> 399805 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.83
External database links:  
ASAP:
ABE-0001307
ECHOBASE:
EB4028
ECOLIHUB:
yaiZ
OU-MICROARRAY:
b0380
STRING:
511145.b0380
COLOMBOS: yaiZ


Product      
Name: DUF2754 domain-containing protein YaiZ
Synonym(s): YaiZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.097
Isoelectric point: 9.033
Motif(s):
 
Type Positions Sequence
1 -> 70 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIRRRDEETENAQ
39 -> 59 QTYAVGLVTWVISFWLAGLII
13 -> 33 YYAFAIGLIFILNGVVGLLGF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6229-MONOMER
ECOLIWIKI:
b0380
INTERPRO:
IPR020490
PFAM:
PF10953
PRIDE:
P0AAQ0
REFSEQ:
NP_414914
UNIPROT:
P0AAQ0


Operon      
Name: yaiZ         
Operon arrangement:
Transcription unit        Promoter
yaiZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiZp6 399444 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiYp5 399460 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiYp6 399547 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_492 (cluster) 399570 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB