RegulonDB RegulonDB 11.1: Gene Form

copA gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

copA glsA ybaQ GadX CueR ppGpp glsAp glsAp TSS_654 TSS_654 copAp copAp TSS_652 TSS_652 TSS_651 TSS_651 TSS_650 TSS_650 ybaPp6 ybaPp6 ybaPp4 ybaPp4 ybaPp3 ybaPp3

Name: copA    Texpresso search in the literature
Synonym(s): ECK0478, G6260, b0484, ybaR
Genome position(nucleotides): 508875 <-- 511379
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Shine dalgarno      
Sequence: aactgtcttaAAGGAGtgtttTAT

Name: soluble Cu+ chaperone
Synonym(s): CopA, CopA(Z), YbaR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.481
Isoelectric point: 5.245
Type Positions Sequence Comment
71 -> 150 KPLAESSIPSEALTAVSEALPAATADDDDSQQLLLSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDL Acts as a regulatory domain, represses or stimulates ATP turnover in a copper dependent manner
205 -> 217 IGDNMMVTADNRS The periplasmic loop structures have been implicated in the interaction of CopA with CusF


Multifun Terms (GenProtEC)  
  4 - transport
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0140581 - P-type monovalent copper transporter activity
GO:0005507 - copper ion binding
GO:0015662 - P-type ion transporter activity
GO:0016887 - ATP hydrolysis activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0019829 - ATPase-coupled cation transmembrane transporter activity
GO:0043682 - P-type divalent copper transporter activity
GO:0015080 - silver ion transmembrane transporter activity
GO:0015662 - P-type ion transporter activity
GO:0016887 - ATP hydrolysis activity
GO:0016531 - copper chaperone activity
biological_process GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0006825 - copper ion transport
GO:0055070 - copper ion homeostasis
GO:0034220 - ion transmembrane transport
GO:0060003 - copper ion export
GO:0035434 - copper ion transmembrane transport
GO:0071280 - cellular response to copper ion
GO:0071292 - cellular response to silver ion
GO:1902601 - silver ion transmembrane transport
GO:0098655 - cation transmembrane transport
GO:0006825 - copper ion transport
GO:0010273 - detoxification of copper ion
Note(s): Note(s): ...[more].
Evidence: [EXP-IDA-UNPURIFIED-PROTEIN] Assay of unpurified protein
Reference(s): [1] Meydan S., et al., 2017
External database links:  

Name: copA         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: CueR

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaPp3 508262 reverse nd [COMP-AINF] [2]
  promoter ybaPp4 508264 reverse nd [COMP-AINF] [2]
  promoter ybaPp6 508284 reverse nd [COMP-AINF] [2]
  promoter TSS_650 511367 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_651 511370 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_652 511395 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_654 511413 reverse nd [RS-EPT-CBR] [3]


 [COMP-AINF] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Meydan S., Klepacki D., Karthikeyan S., Margus T., Thomas P., Jones JE., Khan Y., Briggs J., Dinman JD., Vazquez-Laslop N., Mankin AS., 2017, Programmed Ribosomal Frameshifting Generates a Copper Transporter and a Copper Chaperone from the Same Gene., Mol Cell 65(2):207-219

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
