RegulonDB RegulonDB 10.9: Gene Form
   

ylbG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

selU ylbH ybbD ylbG ybbC ylbI

Gene      
Name: ylbG    Texpresso search in the literature
Synonym(s): ECK0495, G6273, b0502
Genome position(nucleotides): 529645 <-- 530016 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.27
External database links:  
ASAP:
ABE-0001736
ECHOBASE:
EB4033
ECOLIHUB:
ylbG
OU-MICROARRAY:
b0502
STRING:
316407.85674640
COLOMBOS: ylbG


Product      
Name: putative DNA-binding transcriptional regulator YlbG
Synonym(s): YlbG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.916
Isoelectric point: 10.262
Motif(s):
 
Type Positions Sequence
11 -> 74 HKAGLLNLAEELSNVSKACKIMGVSRDTFYRYRELVAEGGVDAQINRSRRAPNLKNRTDEATEQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
biological_process GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48217N
ECOCYC:
G6273-MONOMER
ECOLIWIKI:
b0502
INTERPRO:
IPR009057
INTERPRO:
IPR038965
MODBASE:
P77688
PANTHER:
PTHR42648
PFAM:
PF13551
PRIDE:
P77688
REFSEQ:
NP_415035
SMR:
P77688
UNIPROT:
P77688


Operon      
Name: ylbG         
Operon arrangement:
Transcription unit        Promoter
ylbG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB