RegulonDB RegulonDB 10.9: Gene Form
   

allA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

allS allR allA AllR anti-terminator TSS_671 TSS_671 TSS_670 TSS_670 TSS_669 TSS_669 TSS_668 TSS_668 TSS_667 (cluster) TSS_667 (cluster) allAp allAp allSp allSp selUp5 selUp5 selUp4 selUp4

Gene      
Name: allA    Texpresso search in the literature
Synonym(s): ECK0498, G6275, b0505, glxA2, ybbT
Genome position(nucleotides): 532451 --> 532933 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.14
External database links:  
ASAP:
ABE-0001747
ECHOBASE:
EB3381
ECOLIHUB:
allA
OU-MICROARRAY:
b0505
STRING:
511145.b0505
COLOMBOS: allA


Product      
Name: ureidoglycolate lyase
Synonym(s): AllA, YbbT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.17
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
2 -> 154 KLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.26 - allantoin assimilation
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0004848 - ureidoglycolate hydrolase activity
GO:0050385 - ureidoglycolate lyase activity
biological_process GO:0000256 - allantoin catabolic process
GO:0006144 - purine nucleobase metabolic process
GO:0006145 - purine nucleobase catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6275-MONOMER
ECOLIWIKI:
b0505
INTERPRO:
IPR023525
INTERPRO:
IPR024060
INTERPRO:
IPR011051
INTERPRO:
IPR007247
PANTHER:
PTHR21221
PDB:
1XSQ
PFAM:
PF04115
PRIDE:
P77731
PRODB:
PRO_000022079
REFSEQ:
NP_415038
SMR:
P77731
UNIPROT:
P77731


Operon      
Name: allA         
Operon arrangement:
Transcription unit        Promoter
allA


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR
Growth Conditions:

[1] 

C: Escherichia coli| allS knockout mutant| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM| mid exponential phase
E: Escherichia coli| allS knockout mutant| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM; glyoxylate| mid exponential phase

[2] 

C: Escherichia coli| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM| mid exponential phase
E: Escherichia coli| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM; glyoxylate| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter selUp4 531358 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter selUp5 531362 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_667 (cluster) 532964 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_668 532972 forward nd [RS-EPT-CBR] [2]
  promoter TSS_669 532977 forward nd [RS-EPT-CBR] [2]
  promoter TSS_670 532983 forward nd [RS-EPT-CBR] [2]
  promoter TSS_671 533637 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muńiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB