RegulonDB RegulonDB 10.9: Gene Form
   

glxR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybbW glxR hyi terminator allBp allBp allBp2 allBp2 allBp3 allBp3

Gene      
Name: glxR    Texpresso search in the literature
Synonym(s): ECK0502, G6278, b0509, glxB1, ybbQ
Genome position(nucleotides): 536586 --> 537464 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.74
External database links:  
ASAP:
ABE-0001759
ECHOBASE:
EB3052
ECOLIHUB:
glxR
OU-MICROARRAY:
b0509
STRING:
511145.b0509
COLOMBOS: glxR


Product      
Name: tartronate semialdehyde reductase 2
Synonym(s): GlxR, YbbQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.801
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
2 -> 160 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVG
4 -> 18 GFIGLGIMGTPMAIN
163 -> 283 GDGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.21 - glyoxylate degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0008679 - 2-hydroxy-3-oxopropionate reductase activity
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0046487 - glyoxylate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009436 - glyoxylate catabolic process
GO:0009442 - allantoin assimilation pathway
GO:0046296 - glycolate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6278-MONOMER
ECOLIWIKI:
b0509
INTERPRO:
IPR029154
INTERPRO:
IPR036291
INTERPRO:
IPR015815
INTERPRO:
IPR013328
INTERPRO:
IPR002204
INTERPRO:
IPR006115
INTERPRO:
IPR006398
INTERPRO:
IPR008927
MODBASE:
P77161
PFAM:
PF14833
PFAM:
PF03446
PRIDE:
P77161
PROSITE:
PS00895
REFSEQ:
NP_415042
SMR:
P77161
SWISSMODEL:
P77161
UNIPROT:
P77161


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB