RegulonDB RegulonDB 10.9: Gene Form
   

ybcO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcN rusA ybcO ninE ipeX ylcG ylcH anti-terminator anti-anti-terminator terminator

Gene      
Name: ybcO    Texpresso search in the literature
Synonym(s): ECK0540, G6305, b0549
Genome position(nucleotides): 573084 --> 573374 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0001878
ECHOBASE:
EB3396
ECOLIHUB:
ybcO
OU-MICROARRAY:
b0549
STRING:
511145.b0549
COLOMBOS: ybcO


Product      
Name: DLP12 prophage; putative nuclease YbcO
Synonym(s): DLP12 prophage; DUF1364 domain-containing protein YbcO, YbcO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.348
Isoelectric point: 8.126
Motif(s):
 
Type Positions Sequence
3 -> 92 DLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKPPDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
biological_process GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6305-MONOMER
ECOLIWIKI:
b0549
INTERPRO:
IPR010774
PDB:
3G27
PFAM:
PF07102
PRIDE:
P68661
REFSEQ:
NP_415081
SMR:
P68661
UNIPROT:
P68661


Operon      
Name: ybcN-ninE-ybcO-rusA-ylcG         
Operon arrangement:
Transcription unit        Promoter
ybcN-ninE-ybcO-rusA-ylcG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter quuDp3 573774 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB