RegulonDB RegulonDB 10.9: Gene Form
   

rzpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrD rzpD borD essD rzoD

Gene      
Name: rzpD    Texpresso search in the literature
Synonym(s): ECK0547, G6311, b0556, ybcT
Genome position(nucleotides): 578107 --> 578568 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.3
External database links:  
ASAP:
ABE-0001900
ECHOBASE:
EB3400
ECOLIHUB:
rzpD
OU-MICROARRAY:
b0556
STRING:
511145.b0556
COLOMBOS: rzpD


Product      
Name: DLP12 prophage; putative prophage endopeptidase RzpD
Synonym(s): RzpD, YbcT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.226
Isoelectric point: 9.487
Motif(s):
 
Type Positions Sequence
30 -> 153 AIAYKVQRDKNARELKLANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
biological_process GO:0008152 - metabolic process
GO:0006508 - proteolysis
GO:0019076 - viral release from host cell
GO:0019835 - cytolysis
GO:0042742 - defense response to bacterium
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6311-MONOMER
ECOLIWIKI:
b0556
INTERPRO:
IPR004929
PFAM:
PF03245
PRIDE:
P75719
REFSEQ:
NP_415088
SMR:
P75719
UNIPROT:
P75719


Operon      
Name: essD-rrrD-rzpD         
Operon arrangement:
Transcription unit        Promoter
essD-ybcS-rzpD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB