RegulonDB RegulonDB 10.9: Gene Form
   

ybcW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcV ybcW ylcI ybcWp7 ybcWp7 ybcWp4 ybcWp4

Gene      
Name: ybcW    Texpresso search in the literature
Synonym(s): ECK0551, G6314, b0559
Genome position(nucleotides): 579880 --> 580086 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.61
External database links:  
ASAP:
ABE-0001912
ECHOBASE:
EB3403
ECOLIHUB:
ybcW
OU-MICROARRAY:
b0559
STRING:
511145.b0559
COLOMBOS: ybcW


Product      
Name: DLP12 prophage; uncharacterized protein YbcW
Synonym(s): YbcW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.624
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
1 -> 28 MNKEQSADDPSVDLIRVKNMLNSTISMS
29 -> 68 YPDVVIACIEHKVSLEAFRAIEAALVKHDNNMKDYSLVVD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11340N
ECOCYC:
G6314-MONOMER
ECOLIWIKI:
b0559
PRIDE:
P64435
REFSEQ:
NP_415091
UNIPROT:
P64435


Operon      
Name: ybcW         
Operon arrangement:
Transcription unit        Promoter
ybcW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcWp4 579805 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcWp7 579844 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB