RegulonDB RegulonDB 10.9: Gene Form
   

ybdJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybdK ybdF ybdJ ybdJp3 ybdJp3 ybdJp2 ybdJp2 ybdJp5 ybdJp5 ybdJp4 ybdJp4 ybdFp5 ybdFp5

Gene      
Name: ybdJ    Texpresso search in the literature
Synonym(s): ECK0572, G6325, b0580
Genome position(nucleotides): 605951 <-- 606199 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.6
External database links:  
ASAP:
ABE-0001988
ECHOBASE:
EB3407
ECOLIHUB:
ybdJ
OU-MICROARRAY:
b0580
STRING:
511145.b0580
COLOMBOS: ybdJ


Product      
Name: DUF1158 domain-containing protein YbdJ
Synonym(s): YbdJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.403
Isoelectric point: 8.229
Motif(s):
 
Type Positions Sequence
1 -> 79 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFS
8 -> 28 LTTAAGILLMAFLSCLLLPAP
50 -> 70 LYTLLFCLWFLVLGAIEYFVL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6325-MONOMER
ECOLIWIKI:
b0580
INTERPRO:
IPR010590
PFAM:
PF06643
PRIDE:
P77506
REFSEQ:
NP_415112
SMR:
P77506
UNIPROT:
P77506


Operon      
Name: ybdJ         
Operon arrangement:
Transcription unit        Promoter
ybdJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybdFp5 606053 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdJp4 606223 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdJp5 606264 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdJp2 606405 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdJp3 606411 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB